SMART: PDB domain 1qvj

The domain within your query sequence starts at position 9 and ends at position 158; the E-value for the 1qvj domain shown below is 1e-89.

ENSHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYNPVEYTAVSVLAGPQWADPQISES
NFSPKFNEKDGHVERKSQNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRW
KRDESGNKITHPVSGKCILQFVAIKRKDCG

The domain within your query sequence starts at position 9 and ends at position 158; the E-value for the 1qvj domain shown below is 1e-89.

This is a PDB domain - please see the PDBSUM entry of 1qvj for further annotation